Advanced Search



Monoclonal Anti-EDN3 antibody produced in mouse

SIGMA/WH0001908M1 - clone 2A6-2A4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ET3; Anti-MGC15067; Anti-MGC61498; Anti-endothelin 3

MDL Number: MFCD00162281
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001908M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Western Blotting EDN3 monoclonal antibody, clone 2A6-2A4 Western Blot analysis of EDN3 expression in LNCaP.
Western Blotting Western Blot analysis of EDN3 expression in transfected 293T cell line by EDN3 monoclonal antibody, clone 2A6-2A4. Lanes Lane 1: EDN3 transfected lysate (25.5 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (51.92 kDa).
Immunoprecipitation Immunoprecipitation of EDN3 transfected lysate using anti-EDN3 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with EDN3 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged EDN3 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2A6-2A4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC008876 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P14138 
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed. (provided by RefSeq)
Immunogen: EDN3 (AAH08876, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top