Advanced Search



Monoclonal Anti-EGR1 antibody produced in mouse

SIGMA/WH0001958M3 - clone 6E8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-AT225; Anti-G0S30; Anti-KROX24; Anti-NGFIA; Anti-TIS8; Anti-ZIF268; Anti-ZNF225; Anti-early growth response 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001958M3-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to EGR1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to EGR1 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting EGR1 monoclonal antibody, clone 6E8. Western Blot analysis of EGR1 expression in Raw 264.7.
Western Blotting EGR1 monoclonal antibody, clone 6E8. Western Blot analysis of EGR1 expression in PC-12.
Western Blotting Western Blot analysis of EGR1 expression in transfected 293T cell line by EGR1 monoclonal antibody, clone 6E8. Lanes Lane 1: EGR1 transfected lysate (59.73 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged EGR1 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6E8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_001964 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P08046 
Biochem/physiol Actions: Early-growth response 1 gene (EGR1) facilitates the cellular response to mitogens, stress stimuli and growth factors. It also functions as a tumor suppressor gene in various human cancers. In addition, EGR1 is implicated in the direct regulation of several tumor suppressors such as transforming growth factor β1(TGFβ1), phosphatase and tensin homolog (PTEN), p53 and fibronectin. Mutation in the gene is associated with the development of myeloid disorders.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Early-growth response 1 gene (EGR1) is encoded by the gene mapped to human chromosome 5q31.2. The gene codes for a member of the WT-1 family of transcription factors, which contains three Cys2His2 Zn fingers.
General description: The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. (provided by RefSeq)
Immunogen: EGR1 (NP_001955, 444 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top