Advanced Search



Monoclonal Anti-EIF4EBP1 antibody produced in mouse

SIGMA/WH0001978M1 - clone 4F3-H2, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-4EBP1; Anti-PHASI; Anti-eukaryotic translation initiation factor 4E binding protein 1

MDL Number: MFCD01865141
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001978M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to EIF4EBP1 on HeLa cell. [antibody concentration 10 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between BUB1 and EIF4EBP1. HeLa cells were stained with anti-BUB1 rabbit purified polyclonal 1:1200 and anti-EIF4EBP1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting QC Western Blot detection against Immunogen (38.72 kDa).
ELISA Detection limit for recombinant GST tagged EIF4EBP1 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F3-H2, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC004459 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q13541 
Biochem/physiol Actions: The gene EIF4EBP1 (eukaryotic translation initiation factor 4E binding protein 1) encodes a translation repressor that interacts with eukaryotic translation initiation factor 4E (eIF4E). eIF4E is a multisubunit complex that recruits 40S ribosomal subunits to the 5’ end of mRNA. The interaction of the encoded binding protein with this complex inhibits translation. The phosphorylation of eIF4Ebp1 in response to stimuli such as, UV irradiation and insulin signaling, results in dissociation of this factor from the eIF4E complex, leading to initiation of translation of mRNA. The encoded protein participates in cell proliferation, apoptosis, invasion, and metastasis. It functions as an effector molecule in mTOR (mammalian target of rapamycin complex 1) signaling pathway that regulates protein synthesis. It is found to be overexpressed in hepatocellular carcinoma tissues and serves as a potential prognostic and therapeutic target.
General description: This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5′ end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. (provided by RefSeq)
Immunogen: EIF4EBP1 (AAH04459, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top