Advanced Search



Monoclonal Anti-EIF4G2 antibody produced in mouse

SIGMA/WH0001982M1 - clone 3B5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DAP5; Anti-NAT1; Anti-eukaryotic translation initiation factor 4 gamma, 2; Anti-p97

MDL Number: MFCD01633900
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0001982M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to EIF4G2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 μg/mL]
Western Blotting EIF4G2 monoclonal antibody, clone 3B5. Western Blot analysis of EIF4G2 expression in PC-12.
Western Blotting EIF4G2 monoclonal antibody, clone 3B5 Western Blot analysis of EIF4G2 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (34.43 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3B5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_001418 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity mouse, human, rat
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P78344 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. (provided by RefSeq)
Immunogen: EIF4G2 (NP_001409, 811 a.a. ~ 889 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top