Advanced Search



Monoclonal Anti-FAP antibody produced in mouse

SIGMA/WH0002191M1 - clone 1E5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DPPIV; Anti-FAPA; Anti-SEPRASE; Anti-fibroblast activation protein, alpha

MDL Number: MFCD03791521
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0002191M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of FAP expression in transfected 293T cell line by FAP monoclonal antibody, clone 1E5. Lanes Lane 1: FAP transfected lysate (87.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting FAP monoclonal antibody, clone 1E5 Western Blot analysis of FAP expression in HepG2.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
Immunoprecipitation Immunoprecipitation of FAP transfected lysate using anti-FAP monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with FAP rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged FAP is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1E5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC026250 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q12884 
Application: Monoclonal Anti-FAP antibody produced in mouse has been used in western blotting.
Biochem/physiol Actions: Fibroblast activation protein (FAP) participates in the remodeling of tissue, wound healing, inflammation, fibrosis, and tumor development. It possesses dipeptidyl peptidase and endopeptidase activities. FAP plays a key role in the remodeling of extracellular matrix structure and the reconstruction of tumor microarray. Overexpression of the FAP gene might return epithelial ovarian cancer after chemotherapy. FAP gene expression is involved in cancer cells and premalignant metaplastic cells of the esophagus.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Fibroblast activation protein (FAP), a cell-surface type II transmembrane glycoprotein serine protease, has a cytoplasmic tail, a single transmembrane domain, and an extracellular domain. It is a member of the S9b family of post-proline cleaving enzymes. FAP is localized in the plasma membrane. FAP gene is mapped to human chromosome 2q24.2. Expression of FAP is hardly seen in adult tissues.
Immunogen: FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top