Advanced Search



Monoclonal Anti-FKBP4 antibody produced in mouse

SIGMA/WH0002288M1 - clone 5C11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-FK506 binding protein 4, 59kDa; Anti-FKBP52; Anti-FKBP59; Anti-HBI; Anti-Hsp56; Anti-PPIase; Anti-p52

MDL Number: MFCD01865536
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0002288M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. [antibody concentration 0.5 μg/mL]
Western Blotting FKBP4 monoclonal antibody, clone 5C11. Western Blot analysis of FKBP4 expression in NIH/3T3.
Western Blotting FKBP4 monoclonal antibody, clone 5C11 Western Blot analysis of FKBP4 expression in HeLa.
Western Blotting FKBP4 monoclonal antibody, clone 5C11. Western Blot analysis of FKBP4 expression in PC-12.
Western Blotting FKBP4 monoclonal antibody, clone 5C11. Western Blot analysis of FKBP4 expression in Raw 264.7.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
Immunoprecipitation Immunoprecipitation of FKBP4 transfected lysate using anti-FKBP4 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with FKBP4 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged FKBP4 is approximately 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 5C11, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC007924 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity rat, mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q02790 
General description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. The human genome contains several non-transcribed pseudogenes similar to this gene. (provided by RefSeq)
Immunogen: FKBP4 (AAH07924, 301 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top