Advanced Search



Monoclonal Anti-FOXC2 antibody produced in mouse

SIGMA/WH0002303M2 - clone 2H3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-FKHL14; Anti-MFH1; Anti-forkhead box C2 (MFH-1, mesenchyme forkhead 1)

MDL Number: MFCD06411812
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0002303M2-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to FOXC2 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to FOXC2 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting QC Western Blot detection against Immunogen (34.65 kDa).
ELISA Detection limit for recombinant GST tagged FOXC2 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2H3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_005251 
isotype IgG2bλ
Quality Level 100 
shipped in dry ice
species reactivity mouse, human, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q99958 
Application: Monoclonal Anti-FOXC2 antibody has been used in immunohistochemistry.
Biochem/physiol Actions: Forkhead Box Protein C2 (FOXC2) controls YAP (yes-associated protein) signaling and stimulates the progression of nasopharyngeal carcinoma by promoting glycolysis. It plays a major role in inducing invasion and metastasis. Mutations in FOXC2 result in hereditary Lymphedema-Distichiasis syndrome.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Forkhead Box Protein C2 (FOXC2) is a transcription factor. It belongs to the forkhead/winged-helix family of transcription factors. This gene is located on human chromosome 16q24.
General description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)
Immunogen: FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top