Advanced Search



Monoclonal Anti-GOLGA2 antibody produced in mouse

SIGMA/WH0002801M1 - clone 2C6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-GM130; Anti-MGC20672; Anti-golgi autoantigen, golgin subfamily a, 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0002801M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting GOLGA2 monoclonal antibody, clone 2C6. Western Blot analysis of GOLGA2 expression in human spleen.
Western Blotting QC Western Blot detection against Immunogen (38.94 kDa).
ELISA Detection limit for recombinant GST tagged GOLGA2 is 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2C6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC006381 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q08379 
Biochem/physiol Actions: GOLGA2 (Golgin subfamily A member 2) is highly involved in the maintenance of Golgi structure. The proper maintenance of Golgi structure requires specific lateral cisternal-fusion events. During mitosis, GOLGA2 helps to reorganize Golgi ribbons at a stable structure by proper distribution of enzymes in the Golgi apparatus. It has been reported that GOLGA2 participates in centrosome-associated nucleating activity in association with AKAP450 to extend the Golgi. It also participates in endoplasmic reticulum-to-Golgi transport and mitotic Golgi apparatus fragmentation. It interacts with and stabilizes GRASP65 (Golgi peripheral membrane protein p65).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The golgins are a family of proteins, of which the protein encoded by this gene is a member, that are localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. (provided by RefSeq)
Immunogen: GOLGA2 (AAH06381.1, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top