Advanced Search



Monoclonal Anti-HMGB2 antibody produced in mouse

SIGMA/WH0003148M5 - clone 3E5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HMG2; Anti-high-mobility group box 2

MDL Number: MFCD02263063
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0003148M5-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to HMGB2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to HMGB2 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting HMGB2 monoclonal antibody, clone 3E5 Western Blot analysis of HMGB2 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (47.19 kDa).
ELISA Detection limit for recombinant GST tagged HMGB2 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3E5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC000903 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human, mouse, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P26583 
Biochem/physiol Actions: High-mobility group protein B2 (HMGB2) plays an important role in several cellular functions, from nuclear re-organization and DNA repair to cellular signaling. High expression of HMGB2 is linked with tumor aggressiveness and prognosis of hepatocellular carcinoma.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: High-mobility group protein B2 (HMGB2) is also termed as HMG1 (high-mobility group protein 1) and HMG2. This protein has two similar, but distinct HMG boxes (domains A and B) and a long acidic C-terminal tail. HMGB2 is located on human chromosome 4q.
General description: This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. (provided by RefSeq)
Immunogen: HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top