Advanced Search



Monoclonal Anti-FOXA2 antibody produced in mouse

SIGMA/WH0003170M1 - clone 7E6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HNF3B; Anti-MGC19807; Anti-TCF3B; Anti-forkhead box A2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0003170M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to FOXA2 on HepG2 cell. [antibody concentration 10 μg/mL]
Western Blotting FOXA2 monoclonal antibody, clone 7E6 Western Blot analysis of FOXA2 expression in HepG2.
Western Blotting Western Blot analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody, clone 7E6. Lanes Lane 1: FOXA2 transfected lysate (48.3 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi. Blot probed with FOXA2 monoclonal antibody, clone 7E6. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (36.19 kDa).
Immunoprecipitation Immunoprecipitation of FOXA2 transfected lysate using anti-FOXA2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with FOXA2 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged FOXA2 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 7E6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_021784 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q9Y261 
Biochem/physiol Actions: Forkhead box A2 (FOXA2) expressed in the liver, pancreas, intestine, and lungs, is associated with embryonic formation of the primitive streak and endoderm. It also plays an important role in airway epithelial differentiation and is extensively expressed in type II pneumocytes. Decreased expression of Foxa2 is observed in lung cancer and non-small-cell lung cancer (NSCLC). FOXA2 plays a vital role in normal pancreatic β-cell function, therefore, aberration in the expression of the gene leads to hyperinsulinemic hypoglycemia. FOXA2 also has an essential role in pancreatic α-cell differentiation. FOXA2 expressed along with FOXA1 in the foregut endoderm plays a vital role in liver, hepatic and neuronal development, these factors also have an overlapping role in lung morphogenesis. FOXA2 acts a regulator of the network of gene associated with the intestinal epithelial cell function. Increased expression of FOXA2 in MKN-45 cells (human gastric cancer cell line) elevates E-cadherin expression and inhibits gastric cancer cell migration and invasion and therefore, FOXA2 is expressed at low levels in gastric adenocarcinoma tissues.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq)
Immunogen: FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top