Advanced Search



Monoclonal Anti-IGFBP1 antibody produced in mouse

SIGMA/WH0003484M1 - clone 2F9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-AFBP; Anti-IBP1; Anti-IGFBP25; Anti-PP12; Anti-hIGFBP1; Anti-insulin-like growth factor binding protein 1

MDL Number: MFCD01322209
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0003484M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Western Blotting Western Blot analysis of IGFBP1 expression in transfected 293T cell line by IGFBP1 monoclonal antibody, clone 2F9. Lanes Lane 1: IGFBP1 transfected lysate (Predicted MW: 27.9 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2F9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_000596 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P08833 
Biochem/physiol Actions: Insulin-like growth factor binding protein 1 (IGFBP1) participates in the modulation of fetal growth through the insulin-like growth factor axis. Due to its high-affinity binding, IGFBP1 also controls the IGF bioactivity. It has the capability to bind and regulate the bioavailability of circulating insulin-like growth factors (IGFs).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Insulin-like growth factor binding protein 1 (IGFBP1) is a ~30 kDa secretory protein. It is formed mostly in the liver and kidney. IGFBP1 is a member of the IGFBPs family. This gene is located on human chromosome 7p12.
General description: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. (provided by RefSeq)
Immunogen: IGFBP1 (NP_000587, 160 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top