Advanced Search



Monoclonal Anti-ITGA2 antibody produced in mouse

SIGMA/WH0003673M1 - clone 2B6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-BR; Anti-CD49B; Anti-GPIa; Anti-VLA2; Anti-VLAA2; Anti-integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)

MDL Number: MFCD00162569
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0003673M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to ITGA2 on A-431 cell. [antibody concentration 10 μg/mL]
Western Blotting ITGA2 monoclonal antibody, clone 2B6 Western Blot analysis of ITGA2 expression in A-431.
Western Blotting QC Western Blot detection against Immunogen (35.53 kDa).
ELISA Detection limit for recombinant GST tagged ITGA2 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2B6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_002203 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P17301 
Biochem/physiol Actions: Integrin α2 subunit (ITGA2) plays a role in angiogenesis, cell migration, invasion, and cell survival. This protein acts as a tumor activator in several tumors. ITGA2 protein might be involved in cell adhesion and cell-surface mediated signaling and is highly expressed in several cancers. Overexpression of the ITGA2 gene is observed in pancreatic ductal adenocarcinoma and ovarian cancer.
Biochem/physiol Actions: Integrin subunit α 2 (ITGA2) functions as a platelet receptor of collagen, which is an important activating agent required for platelet aggregation. Mutation in the gene might lead to aspirin insensitivity mainly in Chinese populations and in aspirin semi-resistance. Integrin α2β1 serves as a receptor for collagen and many other extracellular matrix (ECM) complexes. Variation in the gene elevates the expression of α2β1 on platelets and increase the risk of having melanoma, gastric, ovarian cancer, thrombosis, myocardial infarction and stroke. Thus, Integrin α2β1 acts as a potential therapeutic target for thrombosis related diseases, cancer, and inflammation. Cryptosporidium parvum infection, elevates the expression of ITGA2 in the host cell. Therefore, silencing the expression of the ITGA2 by using specific antibodies and the ligand type I collagen (collagen-I), is considered as a promising therapeutic method for treatment of cryptosporidial infection.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Integrin α2 (ITGA2) is a collagen receptor that is present on the platelets and epithelial cells. This protein is highly expressed in normal epithelial cells. The ITGA2 gene is located on the human chromosome at 5q11.2.
Immunogen: ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top