Advanced Search



Monoclonal Anti-MARCKS antibody produced in mouse

SIGMA/WH0004082M6 - clone 2C2, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-80KL; Anti-FLJ14368; Anti-MACS; Anti-MRACKS; Anti-PKCSL; Anti-PRKCSL; Anti-myristoylated alanine-rich protein kinase C substrate

MDL Number: MFCD01633619
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004082M6-50UG 50 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to MARCKS on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to MARCKS on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting MARCKS monoclonal antibody, clone 2C2. Western Blot analysis of MARCKS expression in Raw 264.7. (The predicted M.W. of MARCKS is 29 to 39 kDa, but it seems the actual M.W. in vivo is between 68 to 90 kDa in different species. http://www.pnas.org/content/88/6/2505.full.pdf , http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=177061)
Western Blotting QC Western Blot detection against Immunogen (32.78 kDa).
ELISA Detection limit for recombinant GST tagged MARCKS is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2C2, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_002356 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity mouse
storage temp. −20°C
technique(s) immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P26645 
Application: Monoclonal Anti-MARCKS antibody produced in mouse has been used in immunohistochemistry (1:400).
Biochem/physiol Actions: Myristoylated alanine-rich C-kinase substrate (MARCKS) is involved in mediating brain plasticity, inflammatory response, embryonic development, and regeneration processes. It also plays a key role in cell cycle regulation and transmembrane transport. Various studies have implicated the association of MARCKS with the pathophysiology of glioblastoma, cholangiocarcinoma, melanoma, and many more tumor types.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Myristoylated alanine-rich C-kinase substrate (MARCKS) contains an N-terminal domain (ND), effector domain (ED), and myristoylated MH2 domain. The MARCKS gene is mapped to human chromosome 6q21.
Immunogen: MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top