Advanced Search



Monoclonal Anti-MCM3 antibody produced in mouse

SIGMA/WH0004172M1 - clone 4F7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HCC5; Anti-MCM3 minichromosome maintenance deficient 3 (S. cerevisiae); Anti-MGC1157; Anti-P1.h; Anti-P1MCM3; Anti-RLFB

MDL Number: MFCD02263436
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004172M1-50UG 50 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting MCM3 monoclonal antibody, clone 4F7 Western Blot analysis of MCM3 expression in COLO 320 HSR.
Western Blotting MCM3 monoclonal antibody, clone 4F7. Western Blot analysis of MCM3 expression in Raw 264.7.
Western Blotting MCM3 monoclonal antibody, clone 4F7. Western Blot analysis of MCM3 expression in Daoy.
Western Blotting MCM3 monoclonal antibody, clone 4F7. Western Blot analysis of MCM3 expression in A-431.
Western Blotting MCM3 monoclonal antibody, clone 4F7. Western Blot analysis of MCM3 expression in HeLa.
Western Blotting MCM3 monoclonal antibody, clone 4F7. Western Blot analysis of MCM3 expression in K-562.
Western Blotting MCM3 monoclonal antibody, clone 4F7. Western Blot analysis of MCM3 expression in human colon.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
ELISA Detection limit for recombinant GST tagged MCM3 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_002388 
isotype IgG2aλ
Quality Level 100 
shipped in dry ice
species reactivity mouse
storage temp. −20°C
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P25206 
General description: The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. (provided by RefSeq)
Immunogen: MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top