Advanced Search



Monoclonal Anti-MDM2 antibody produced in mouse

SIGMA/WH0004193M1 - clone 1A7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-MGC71221; Anti-Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse); Anti-hdm2

MDL Number: MFCD00282354
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004193M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to MDM2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between TP53 and MDM2. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MDM2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting Western Blot analysis of MDM2 expression in transfected 293T cell line by MDM2 monoclonal antibody, clone 1A7. Lanes Lane 1: MDM2 transfected lysate (55.2 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of MDM2 over-expressed 293 cell line, cotransfected with MDM2 Validated Chimera RNAi. Blot probed with MDM2 monoclonal antibody, clone 1A7. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged MDM2 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1A7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_002392 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human, rat, mouse
storage temp. −20°C
technique(s) indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q00987 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene is a target gene of the transcription factor tumor protein p53. The encoded protein is a nuclear phosphoprotein that binds and inhibits transactivation by tumor protein p53, as part of an autoregulatory negative feedback loop. Overexpression of this gene can result in excessive inactivation of tumor protein p53, diminishing its tumor suppressor function. This protein has E3 ubiquitin ligase activity, which targets tumor protein p53 for proteasomal degradation. This protein also affects the cell cycle, apoptosis, and tumorigenesis through interactions with other proteins, including retinoblastoma 1 and ribosomal protein L5. More than 40 different alternatively spliced transcript variants have been isolated from both tumor and normal tissues. (provided by RefSeq)
Immunogen: MDM2 (NP_002383, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top