Advanced Search



Monoclonal Anti-MAP3K4 antibody produced in mouse

SIGMA/WH0004216M2 - clone 6C6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-KIAA0213; Anti-MAPKKK4; Anti-MEKK4; Anti-MTK1; Anti-PRO0412; Anti-mitogen-activated protein kinase kinase kinase 4

MDL Number: MFCD08705590
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004216M2-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to MAP3K4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 μg/mL]
Western Blotting MAP3K4 monoclonal antibody, clone 6C6 Western Blot analysis of MAP3K4 expression in NIH/3T3.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6C6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_005922 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O08648 
Biochem/physiol Actions: MAP3K4 (mitogen-activated protein kinase kinase kinase 4) phosphorylates and activates a specific MAPK kinase (MAPKK) in the cascade through phosphorylation of conserved threonine and/or serine residues. GADD45 (growth arrest and DNA-damage-inducible proteins) proteins interact with and free the autoinhibitory domain from the kinase domain, thus activating MAP3K4. It mediates the activation of p38 MAPK pathway and the JNK (c-Jun N-terminal kinase) pathway induced by environmental stresses.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: MAP3K4 (mitogen-activated protein kinase kinase kinase 4) gene encodes a component of protein kinase signal transduction cascade. It is also termed as MTK1 (MAP3 kinase 1). MAP3K4 contains a protein kinase catalytic domain at the C terminus and a regulatory/autoinhibitory domain at the N-terminus. It is located on human chromosome 6q26.
General description: The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAPK. While the ERK MAPKs are activated by mitogenic stimulation, the CSBP2 and JNK MAPKs are activated by environmental stresses such as osmotic shock, UV irradiation, wound stress, and inflammatory factors. This gene encodes a MAPKKK, the MEKK4 protein, also called MTK1. This protein contains a protein kinase catalytic domain at the C terminus. The N-terminal nonkinase domain may contain a regulatory domain. Expression of MEKK4 in mammalian cells activated the CSBP2 and JNK MAPK pathways, but not the ERK pathway. In vitro kinase studies indicated that recombinant MEKK4 can specifically phosphorylate and activate PRKMK6 and SERK1, MAPKKs that activate CSBP2 and JNK, respectively but cannot phosphorylate PRKMK1, an MAPKK that activates ERKs. MEKK4 is a major mediator of environmental stresses that activate the CSBP2 MAPK pathway, and a minor mediator of the JNK pathway. Two alternatively spliced transcripts encoding distinct isoforms have been described. (provided by RefSeq)
Immunogen: MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top