Advanced Search



Monoclonal Anti-MIF antibody produced in mouse

SIGMA/WH0004282M1 - clone 2A10-4D3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-GIF; Anti-GLIF; Anti-MMIF; Anti-macrophage migration inhibitory factor (glycosylation-inhibiting factor)

MDL Number: MFCD00211612
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004282M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma tissue. [antibody concentration 1 ~ 10 μg/mL]
Western Blotting Western Blot analysis of MIF expression in transfected 293T cell line by MIF monoclonal antibody, clone 2A10-4D3. Lanes Lane 1: MIF transfected lysate (12.5 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (38.39 kDa).
Immunoprecipitation Immunoprecipitation of MIF transfected lysate using anti-MIF monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with MIF rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged MIF is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2A10-4D3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC000447 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P14174 
Biochem/physiol Actions: Macrophage migration inhibitory factor (MIF) can induce inflammation. Aberrations in MIF result in several inflammatory diseases, such as ulcerative colitis (UC), psoriasis and tuberculosis (TB).(1) It controls the anti-inflammator effects of glucocorticoids. MIF plays pro-inflammatory roles in inflammatory diseases like rheumatoid arthritis, sepsis, acute respiratory distress syndrome and glomerulonephritis.(2)
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Macrophage migration inhibitory factor (MIF) is a 37.5kDa homotrimer protein. It is expressed in various cells like monocytes, macrophages, vascular smooth muscle cells (SMCs) and cardiomyocytes. This gene is located on human chromosome 21q22.33.(1)
General description: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. (provided by RefSeq)
Immunogen: MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top