Advanced Search



Monoclonal Anti-CITED1 antibody produced in mouse

SIGMA/WH0004435M1 - clone 6G8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1; Anti-MSG1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004435M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody, clone 6G8. Lanes Lane 1: CITED1 transfected lysate (19.9 kDa). Lane 2: Non-transfected lysate.
Western Blotting CITED1 monoclonal antibody, clone 6G8. Western Blot analysis of CITED1 expression in PC-12.
Western Blotting CITED1 monoclonal antibody, clone 6G8 Western Blot analysis of CITED1 expression in A-431.
Enhanced Validation-RNAi Western blot analysis of CITED1 over-expressed 293 cell line, cotransfected with CITED1 Validated Chimera RNAi. Blot probed with CITED1 monoclonal antibody, clone 6G8. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged CITED1 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6G8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_004143 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human, rat, mouse
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q99966 
Biochem/physiol Actions: CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) controls cellular activities of the metanephric mesenchyme. This gene is linked to papillary thyroid carcinoma. MSG1 is involved in pigmentation. It also participates in malignant transformation of pigment cells.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: CITED1 (Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1)/MSG1 (melanocyte-specific gene 1) is a non-DNA binding transcriptional co-activator. It has a smad-4 interacting domain (SID) and a conserved region 2 (CR2) domain. This gene codes for a 27 kDa protein that belongs to the CITED (CBP/p300-interacting transactivators with glutamic acid [E] and aspartic acid [D]-rich C-terminal domain) family of nuclear proteins. CITED1 is located on human chromosome Xq13.
General description: This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. (provided by RefSeq)
Immunogen: CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top