Advanced Search



Monoclonal Anti-MSX1 antibody produced in mouse

SIGMA/WH0004487M3 - clone 2B12, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HOX7; Anti-HYD1; Anti-msh homeobox homolog 1 (Drosophila)

MDL Number: MFCD07370403
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004487M3-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunoprecipitation Immunoprecipitation of MSX1 transfected lysate using anti-MSX1 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with MSX1 rabbit polyclonal antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2B12, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_002448 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
UniProt accession no. P28360 
General description: This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. (provided by RefSeq)
Immunogen: MSX1 (NP_002439, 216 a.a. ~ 297 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top