Advanced Search



Monoclonal Anti-MUSK antibody produced in mouse

SIGMA/WH0004593M1 - clone 1F3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-MGC126323; Anti-MGC126324; Anti-muscle, skeletal, receptor tyrosine kinase

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004593M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting MUSK monoclonal antibody, clone 1F3 Western Blot analysis of MUSK expression in Jurkat.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
ELISA Detection limit for recombinant GST tagged MUSK is 3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1F3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_005592 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O15146 
General description: Intercellular communication is often mediated by receptors on the surface of one cell that recognize and are activated by specific protein ligands released by other cells. Members of one class of cell surface receptors, receptor tyrosine kinases (RTKs), are characterized by having a cytoplasmic domain containing intrinsic tyrosine kinase activity. This kinase activity is regulated by the binding of a cognate ligand to the extracellular portion of the receptor. DeChiara et al. (1996) [PubMed 8653786] noted that the RTKs, known to be expressed in cell type-specific fashions, play a role critical for the growth and differentiation of those cell types. For example, members of the neural-specific TRK family that recognize nerve growth factor are absolutely required for the survival and development of discrete neuronal subpopulations, and the receptor tyrosine kinases TIE1 (MIM 600222) and TIE2 (MIM 600221) play a critical role in the development of normal blood vessels.[supplied by OMIM
Immunogen: MUSK (NP_005583, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top