Advanced Search



Monoclonal Anti-NEUROD1 antibody produced in mouse

SIGMA/WH0004760M1 - clone 3H8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-BETA2; Anti-BHF1; Anti-NEUROD; Anti-neurogenic differentiation 1

MDL Number: MFCD03097085
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004760M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to NEUROD1 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to NEUROD1 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of NEUROD1 expression in transfected 293T cell line by NEUROD1 monoclonal antibody, clone 3H8. Lanes Lane 1: NEUROD1 transfected lysate (39.9 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
ELISA Detection limit for recombinant GST tagged NEUROD1 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3H8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC009046 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q13562 
Biochem/physiol Actions: Neuronal differentiation 1 (NeuroD1) may mediate the genesis of functional neurons from glial cells. Its higher expression favors neural differentiation in elder rats. NeuroD1 may be crucial for reversing functional impairment by favoring axonal regeneration in nerve injury. Various mutations in NEUROD1 reported have direct implications in the pathophysiology of early-onset diabetes, retinal dystrophy, nonsyndromic retinitis pigmentosa, and neurological abnormalities.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Neuronal differentiation 1 (NeuroD1) belongs to the family of a basic helix-loop-helix transcription factor. The NEUROD1 gene is localized on human chromosome 2q31.3 and is expressed in developing neurons.
Immunogen: NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top