Advanced Search



Monoclonal Anti-NFE2L2 antibody produced in mouse

SIGMA/WH0004780M1 - clone 1F3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-NRF2; Anti-nuclear factor (erythroid-derived 2)-like 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0004780M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunoblotting Monoclonal Anti-NFE2L2, Cat. No. WH0004780M1 used at the antibody concentration: 1 ~ 5 μg/mL. Specific band of ~67.8 kDa using SJCRH30 lysate.
Immunoblotting Monoclonal Anti-NFE2L2, Cat. No. WH0004780M1 used at the antibody concentration: 1 μg/mL. Specific band of ~37.11 kDa using immunogen protein lysate.
Immunohistochemistry Monoclonal Anti-NFE2L2, Cat. No. WH0004780M1; antibody concentration: 1 μg/mL using human lung tissue.
Immunofluorescence Monoclonal Anti-NFE2L2, Cat. No. WH0004780M1; antibody concentration: 10 μg/mL using HeLa cell.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1F3, monoclonal
conjugate unconjugated
form buffered aqueous solution
immunogen sequence FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA (without GST)
isotype IgG2bκ
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: suitable
UniProt accession no. Q16236 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: NFE2L2 (AAH11558, a.a. 71-170) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Physical form: Solution in phosphate buffered saline, pH 7.2
RIDADR NONH for all modes of transport
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top