Advanced Search



Monoclonal Anti-PARK2 antibody produced in mouse

SIGMA/WH0005071M1 - clone 1H4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ARJP; Anti-PDJ; Anti-PRKN; Anti-Parkinson disease (autosomal recessive, juvenile) 2, parkin

MDL Number: MFCD02263896
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005071M1-100UG 100 µg
$503.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to PARK2 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting PARK2 monoclonal antibody, clone 1H4. Western Blot analysis of PARK2 expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged PARK2 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1H4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC022014 
isotype IgG3κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
Biochem/physiol Actions: Parkin RBR E3 ubiquitin protein ligase (PARK2) catalyzes the monoubiquitination and polyubiquitination of proteins to regulate various cellular processes. The encoded protein plays a vital role in synaptic regulation. Genetic variations in the gene leads to autosomal recessive Parkinson’s disease (AR-PD) and sporadic PD.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The parkin RBR E3 ubiquitin protein ligase (PARK2) gene, with 12 exons spanning 1.35Mb on genomic DNA, is mapped to human chromosome 6q26. The gene codes for E3 ubiquitin-protein ligase parkin. The protein contains conserved ubiquitin-like domain (UBL) at N- terminal and four zinc coordinating domains, such as, RING0, RING1, in between ring (IBR) and RING2 domains at C-terminal.
General description: The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. (provided by RefSeq)
Immunogen: PARK2 (AAH22014, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top