Advanced Search



Monoclonal Anti-PAX9 antibody produced in mouse

SIGMA/WH0005083M3 - clone 4B9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-paired box gene 9

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005083M3-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting PAX9 monoclonal antibody, clone 4B9 Western Blot analysis of PAX9 expression in HeLa S3 NE.
Western Blotting Western Blot analysis of PAX9 expression in transfected 293T cell line by PAX9 monoclonal antibody, clone 4B9. Lanes Lane 1: PAX9 transfected lysate (36.3 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of PAX9 over-expressed 293 cell line, cotransfected with PAX9 Validated Chimera RNAi. Blot probed with PAX9 monoclonal antibody, clone 4B9. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting PAX9 monoclonal antibody, clone 4B9. Western Blot analysis of PAX9 expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (36.56 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4B9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_006194 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity mouse, rat, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P55771 
General description: This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 9 gene is unknown but it may involve development of stratified squamous epithelia as well as various organs and skeletal elements. (provided by RefSeq)
Immunogen: PAX9 (NP_006185, 205 a.a. ~ 300 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RSITDQVSDSSPYHSPKVEEWSSLGRNNFPAAAPHAVNGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGH
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top