Advanced Search



Monoclonal Anti-PCSK1 antibody produced in mouse

SIGMA/WH0005122M2 - clone 3D2, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-NEC1; Anti-PC1; Anti-PC3; Anti-SPC3; Anti-proprotein convertase subtilisin/kexin type 1

MDL Number: MFCD03455801
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005122M2-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to PCSK1 on HeLa cell. [antibody concentration 30 μg/mL]
Western Blotting PCSK1 monoclonal antibody, clone 3D2 Western Blot analysis of PCSK1 expression in HeLa.
Western Blotting PCSK1 monoclonal antibody, clone 3D2. Western Blot analysis of PCSK1 expression in Raw 264.7.
Western Blotting PCSK1 monoclonal antibody, clone 3D2. Western Blot analysis of PCSK1 expression in NIH/3T3.
Western Blotting PCSK1 monoclonal antibody, clone 3D2. Western Blot analysis of PCSK1 expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (36.96 kDa).
ELISA Detection limit for recombinant GST tagged PCSK1 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3D2, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_000439 
isotype IgG3κ
Quality Level 100 
shipped in dry ice
species reactivity rat, mouse, human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P29120 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a type I proinsulin-processing enzyme that plays a key role in regulating insulin biosynthesis. It is also known to cleave proopiomelanocortin, prorenin, proenkephalin, prodynorphin, prosomatostatin and progastrin. Mutations in this gene are thought to cause obesity. This encoded protein is associated with carcinoid tumors. The use of alternate polyadenylation sites has been found for this gene. Multiple alternatively spliced transcript variants have been described for this gene but their full length nature is not known. (provided by RefSeq)
Immunogen: PCSK1 (NP_000430, 652 a.a. ~ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGRRDELEEGAPSEAMLRLLQSAFSKNSPPKQSPKKSPTAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top