Advanced Search



Monoclonal Anti-PDGFRA antibody produced in mouse

SIGMA/WH0005156M1 - clone 2D2-1A11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CD140A; Anti-MGC74795; Anti-PDGFR2; Anti-platelet-derived growth factor receptor, alpha polypeptide

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005156M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between PDGFA and PDGFRA. HeLa cells were stained with anti-PDGFA rabbit purified polyclonal 1:1200 and anti-PDGFRA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting Western Blot analysis of PDGFRA expression in transfected 293T cell line by PDGFRA monoclonal antibody, clone 2D2-1A11. Lanes Lane 1: PDGFRA transfected lysate (Predicted MW: 122.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (47.08 kDa).
ELISA Detection limit for recombinant GST tagged PDGFRA is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2D2-1A11, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC015186 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P16234 
Biochem/physiol Actions: Platelet-derived growth factor receptor α (PDGFRA) plays a vital role in the development and maturation of platelets. It serves as a potential target for imatinib, a revolutionary drug for the treatment of chronic myeloid leukemia. PDGFRA pathway may participate in the developmental process of thrombocytes. Mutation in the gene results in gastrointestinal stromal tumors (GISTs).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies in knockout mice, where homozygosity is lethal, indicate that the alpha form of the platelet-derived growth factor receptor is particularly important for kidney development since mice heterozygous for the receptor exhibit defective kidney phenotypes. (provided by RefSeq)
Platelet-derived growth factor receptor α (PDGFRA) is also termed as cluster of differentiation 140a (CD140a). It is is encoded by the gene mapped to human chromosome 4q12. The encoded protein belongs to the receptor tyrosine kinase gene family.
Immunogen: PDGFRA (AAH15186, 25 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top