Advanced Search



Monoclonal Anti-PHF2 antibody produced in mouse

SIGMA/WH0005253M2 - clone 3E7, ascites fluid

Synonym: Anti-GRC5; Anti-KIAA0662; Anti-PHD finger protein 2

MDL Number: MFCD03791931
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005253M2-200UL 200 µL
$524.00
1/EA
Add To Favorites
Immunoblotting Monoclonal Anti-PHF2, Cat. No. WH0005253M2 used at the antibody concentration: 1 μg/mL. Specific band of ~37 kDa using immunogen protein lysate.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 3E7, monoclonal
conjugate unconjugated
GenBank® accession no. NM_005392 
isotype IgMκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1:500-1:1000
UniProt accession no. O75151 
General description: This gene encodes a protein which contains a zinc finger-like PHD (plant homeodomain) finger, distinct from other classes of zinc finger motifs, and a hydrophobic and highly conserved domain. The PHD finger shows the typical Cys4-His-Cys3 arrangement. PHD finger genes are thought to belong to a diverse group of transcriptional regulators possibly affecting eukaryotic gene expression by influencing chromatin structure. (provided by RefSeq)
Immunogen: PHF2 (NP_005383, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top