Advanced Search



Monoclonal Anti-PITX1 antibody produced in mouse

SIGMA/WH0005307M1 - clone 5G4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-BFT; Anti-POTX; Anti-PTX1; Anti-paired-like homeodomain transcription factor 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005307M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Enhanced Validation-RNAi Western blot analysis of PITX1 over-expressed 293 cell line, cotransfected with PITX1 Validated Chimera RNAi. Blot probed with PITX1 monoclonal antibody, clone 5G4. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting PITX1 monoclonal antibody, clone 5G4 Western Blot analysis of PITX1 expression in HeLa S3 NE.
Western Blotting Western Blot analysis of PITX1 expression in transfected 293T cell line by PITX1 monoclonal antibody, clone 5G4. Lanes Lane 1: PITX1 transfected lysate (34.1 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (35.53 kDa).
Immunoprecipitation Immunoprecipitation of PITX1 transfected lysate using anti-PITX1 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with PITX1 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged PITX1 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 5G4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_002653 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P78337 
General description: This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. (provided by RefSeq)
Immunogen: PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top