Advanced Search



Monoclonal Anti-PML antibody produced in mouse

SIGMA/WH0005371M2 - clone 1D12, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-MYL; Anti-PP8675; Anti-RNF71; Anti-TRIM19; Anti-promyelocytic leukemia

MDL Number: MFCD06412254
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005371M2-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to PML on HeLa cell. [antibody concentration 10 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between TP53 and PML. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-PML mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting PML monoclonal antibody, clone 1D12 Western Blot analysis of PML expression in HeLa S3 NE.
Western Blotting PML monoclonal antibody, clone 1D12. Western Blot analysis of PML expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
ELISA Detection limit for recombinant GST tagged PML is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1D12, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC000080 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity mouse, human, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P29590 
Biochem/physiol Actions: Promyelocytic leukemia (PML) helps in the complete formation of the nuclear body. It can serve as a transcriptional cofactor. PML plays major roles in modulating cell morphology, proliferation and migration. It has the capability to block the ubiquitination and proteasomal degradation processes. Cytoplasmic PML is required to control TGF-β1 (transforming growth factor β 1) signaling.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Promyelocytic leukemia (PML) is a 70 KDa protein, made of 560 amino acids.
PML is present in the nucleus. It has 9 coding exons and is mapped to human chromosome 15q24.
Immunogen: PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top