Advanced Search



Monoclonal Anti-PPM1B antibody produced in mouse

SIGMA/WH0005495M1 - clone 1A3-2A4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-MGC21657; Anti-PP2CB; Anti-PP2CBETA; Anti-PP2CbetaX; Anti-PPC2BETAX; Anti-protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005495M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to PPM1B on HeLa cell. [antibody concentration 10 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between ARRB2 and PPM1B. HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and anti-PPM1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Enhanced Validation-RNAi Western blot analysis of PPM1B over-expressed 293 cell line, cotransfected with PPM1B Validated Chimera RNAi. Blot probed with PPM1B monoclonal antibody, clone 1A3-2A4. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of PPM1B expression in transfected 293T cell line by PPM1B monoclonal antibody, clone 1A3-2A4. Lanes Lane 1: PPM1B transfected lysate (52.643 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (46.86 kDa).
Immunoprecipitation Immunoprecipitation of PPM1B transfected lysate using anti-PPM1B monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with PPM1B monoclonal antibody.
ELISA Detection limit for recombinant GST tagged PPM1B is 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1A3-2A4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC012002 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O75688 
General description: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences. (provided by RefSeq)
Immunogen: PPM1B (AAH12002, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top