Advanced Search



Monoclonal Anti-PRKAA2 antibody produced in mouse

SIGMA/WH0005563M2 - clone 1G8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-AMPK; Anti-AMPK2; Anti-PRKAA; Anti-protein kinase, AMP-activated, alpha 2 catalytic subunit

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005563M2-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to PRKAA2 on HeLa cell. [antibody concentration 10 μg/mL]
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between STK11 and PRKAA2. HeLa cells were stained with anti-STK11 rabbit purified polyclonal 1:1200 and anti-PRKAA2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Enhanced Validation-RNAi Western blot analysis of PRKAA2 over-expressed 293 cell line, cotransfected with PRKAA2 Validated Chimera RNAi. Blot probed with PRKAA2 monoclonal antibody (M02) clone 1G8. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of PRKAA2 expression in transfected 293T cell line by PRKAA2 monoclonal antibody, clone 1G8. Lanes Lane 1: PRKAA2 transfected lysate (62.3 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged PRKAA2 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1G8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_006252 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P54646 
General description: The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. Studies of the mouse counterpart suggest that this catalytic subunit may control whole-body insulin sensitivity and is necessary for maintaining myocardial energy homeostasis during ischemia. (provided by RefSeq)
Immunogen: PRKAA2 (NP_006243, 453 a.a. ~ 552 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top