Advanced Search



Monoclonal Anti-PRKCD antibody produced in mouse

SIGMA/WH0005580M6 - clone 2E12, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-1-May; Anti-MGC49908; Anti-nPKCdelta; Anti-protein kinase C, delta

MDL Number: MFCD00162772
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005580M6-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to PRKCD on A-431 cell. [antibody concentration 10 μg/mL]
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
ELISA Detection limit for recombinant GST tagged PRKCD is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2E12, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_006254 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity mouse, rat, human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q05655 
General description: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play distinct roles in cells. The protein encoded by this gene is one of the PKC family members. Studies both in human and mice demonstrate that this kinase is involved in B cell signaling and in the regulation of growth, apoptosis, and differentiation of a variety of cell types. Alternatively spliced transcript variants encoding the same protein have been observed. (provided by RefSeq)
Immunogen: PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top