Advanced Search



Monoclonal Anti-PRKCZ antibody produced in mouse

SIGMA/WH0005590M1 - clone 2D1, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-PKC2; Anti-protein kinase C, zeta

MDL Number: MFCD00162775
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005590M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Enhanced Validation-RNAi Western blot analysis of PRKCZ over-expressed 293 cell line, cotransfected with PRKCZ Validated Chimera RNAi. Blot probed with PRKCZ monoclonal antibody (M01) clone 2D1. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of PRKCZ expression in transfected 293T cell line by PRKCZ monoclonal antibody, clone 2D1. Lanes Lane 1: PRKCZ transfected lysate (67.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (35.42 kDa).
ELISA Detection limit for recombinant GST tagged PRKCZ is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2D1, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC008058 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q05513 
Biochem/physiol Actions: PRKCZ (Protein kinase C ζ) is involved in a variety of cellular processes including cell proliferation, cell motility, and cell survival. It acts as a regulatory molecule in the insulin signaling pathways. It has been suggested that PRKCZ performs downstream of phosphatidylinositol 3-kinase (PI 3-kinase) in the insulin signal pathway for the translocation of GLUT4-encoded protein. It has also been reported that PRKCZ may act as a negative regulator by phosphorylating insulin receptor substrate-1 (IRS-1), which restricts its ability to activate phosphatidylinositol 3-kinase in response to insulin. It has been documented that PRKCZ might be involved in the pathogenesis of type 2 diabetes mellitus (T2DM). PRKCZ also has been reported to be part of various signaling pathways such as ERK/MAPK activation pathway, p70 ribosomal S6 kinase signaling cascade, activation of transcription factor NF-κB. It also plays a role in the regulation of cell polarity. Study predicts that PRKCZ may have a role in the ovarian cancer progression.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine. Furthermore, it is insensitive to typical PKC inhibitors and cannot be activated by phorbol ester. Unlike the classical PKC isoenzymes, it has only a single zinc finger module. These structural and biochemical properties indicate that the zeta subspecies is related to, but distinct from other isoenzymes of PKC. Alternative splicing results in multiple transcript variants encoding different isoforms. (provided by RefSeq)
Immunogen: PRKCZ (AAH08058, 165 a.a. ~ 255 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLI
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top