Advanced Search



Monoclonal Anti-MAPK3 antibody produced in mouse

SIGMA/WH0005595M1 - clone 3C9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ERK1; Anti-P44ERK1; Anti-P44MAPK; Anti-PRKM3; Anti-mitogen-activated protein kinase 3

MDL Number: MFCD02179320
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005595M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to MAPK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to MAPK3 on HeLa cell. [antibody concentration 25 μg/mL]
Western Blotting MAPK3 monoclonal antibody, clone 3C9 Western Blot analysis of MAPK3 expression in A-431.
Western Blotting Western Blot analysis of MAPK3 expression in transfected 293T cell line by MAPK3 monoclonal antibody, clone 3C9. Lanes Lane 1: MAPK3 transfected lysate (43.1 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
Immunoprecipitation Immunoprecipitation of MAPK3 transfected lysate using anti-MAPK3 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with MAPK3 monoclonal antibody.
ELISA Detection limit for recombinant GST tagged MAPK3 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3C9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC013992 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P27361 
General description: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. (provided by RefSeq)
Immunogen: MAPK3 (AAH13992, 279 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top