Advanced Search



Monoclonal Anti-PROC antibody produced in mouse

SIGMA/WH0005624M1 - clone 3A10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-PROC1; Anti-protein C; Anti-protein C (inactivator of coagulation factors Va and VIIIa)

MDL Number: MFCD00162768
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005624M1-50UG 50 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Western Blotting PROC monoclonal antibody, clone 3A10. Western Blot analysis of PROC expression in human liver.
Western Blotting Western Blot analysis of PROC expression in transfected 293T cell line by PROC monoclonal antibody, clone 3A10. Lanes Lane 1: PROC transfected lysate (Predicted MW: 52.1 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.41 kDa).
Immunoprecipitation Immunoprecipitation of PROC transfected lysate using anti-PROC monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with PROC rabbit polyclonal antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3A10, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC034377 
isotype IgG1κ
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P04070 
General description: The PROC gene encodes protein C (EC 3.4.21.69), a vitamin K-dependent plasma glycoprotein that is a key component of the anticoagulant system. Protein C is cleaved to its activated form, ′activated protein C′ (APC) on endothelial cells by the thrombin-thrombomodulin complex (MIM 176930; MIM 188040) and then acts as a serine protease to degrade the activated forms of coagulation factors V (F5; MIM 612309) and VIII (F8; see MIM 306700). Protein S (PROS1; MIM 176880), also a vitamin K-dependent plasma protein, functions as a cofactor to activated protein C.[supplied by OMIM
Immunogen: PROC (AAH34377, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFC
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top