Advanced Search



Monoclonal Anti-PSME2 antibody produced in mouse

SIGMA/WH0005721M2 - clone 1G4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-PA28B; Anti-PA28beta; Anti-REGbeta; Anti-proteasome (prosome, macropain) activator subunit 2 (PA28 beta)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005721M2-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to PSME2 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 6 μg/mL]
Western Blotting Western Blot analysis of PSME2 expression in transfected 293T cell line by PSME2 monoclonal antibody, clone 1G4. Lanes Lane 1: PSME2 transfected lysate (27.4 kDa). Lane 2: Non-transfected lysate.
Western Blotting PSME2 monoclonal antibody, clone 1G4 Western Blot analysis of PSME2 expression in MCF-7.
Western Blotting QC Western Blot detection against Immunogen (35.64 kDa).
Immunoprecipitation Immunoprecipitation of PSME2 transfected lysate using anti-PSME2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with PSME2 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged PSME2 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1G4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_002818 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q9UL46 
General description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13. (provided by RefSeq)
Immunogen: PSME2 (NP_002809, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top