Advanced Search



Monoclonal Anti-RAD51C antibody produced in mouse

SIGMA/WH0005889M1 - clone 3F3-5C6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-RAD51 homolog C (S. cerevisiae); Anti-RAD51L2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005889M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Western Blotting Western Blot analysis of RAD51C expression in transfected 293T cell line by RAD51C monoclonal antibody, clone 3F3-5C6. Lanes Lane 1: RAD51C transfected lysate (42.2 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of RAD51C over-expressed 293 cell line, cotransfected with RAD51C Validated Chimera RNAi. Blot probed with RAD51C monoclonal antibody, clone 3F3-5C6. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting RAD51C monoclonal antibody, clone 3F3-5C6 Western Blot analysis of RAD51C expression in HeLa.
Western Blotting RAD51C monoclonal antibody, clone 3F3-5C6. Western Blot analysis of RAD51C expression in 293.
Western Blotting QC Western Blot detection against Immunogen (40.48 kDa).
ELISA Detection limit for recombinant GST tagged RAD51C is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3F3-5C6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC000667 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O43502 
Biochem/physiol Actions: RAD51 paralog C (RAD51C) aids in the recruitment of the enzyme RAD51 to DNA break sites. It may be involved in modulating its translocation from the cytoplasm to the nucleus. RAD51C has a role in genomic stability and homologous recombination repair. It has been associated with breast and ovarian cancer. Mutations in the gene encoding RAD51C have been linked to Fanconi anemia.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: RAD51 paralog C (RAD51C) is a tumor suppressor gene. It belongs to the RAD51-like gene family and the gene encoding it is localized on human chromosome 17q23.
Immunogen: RAD51C (AAH00667.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top