Advanced Search



Monoclonal Anti-RFC4 antibody produced in mouse

SIGMA/WH0005984M1 - clone 1C12, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-A1; Anti-MGC27291; Anti-RFC37; Anti-replication factor C (activator 1) 4, 37kDa

MDL Number: MFCD07370475
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0005984M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to RFC4 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 μg/mL]
Western Blotting RFC4 monoclonal antibody, clone 1C12 Western Blot analysis of RFC4 expression in K-562.
Enhanced Validation-RNAi Western blot analysis of RFC4 over-expressed 293 cell line, cotransfected with RFC4 Validated Chimera RNAi. Blot probed with RFC4 monoclonal antibody, clone 1C12. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 monoclonal antibody, clone 1C12. Lanes Lane 1: RFC4 transfected lysate (39.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.73 kDa).
ELISA Detection limit for recombinant GST tagged RFC4 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1C12, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC017452 
isotype IgGκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P35249 
General description: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. (provided by RefSeq)
Immunogen: RFC4 (AAH17452, 254 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top