Advanced Search



Monoclonal Anti-SGK antibody produced in mouse

SIGMA/WH0006446M1 - clone 4D7-G3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-SGK1; Anti-serum/glucocorticoid regulated kinase

MDL Number: MFCD02686615
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006446M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human stomach tissue. [antibody concentration 5 μg/mL]
Immunohistochemistry Immunoperoxidase of monoclonal antibody to SGK on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to SGK on HeLa cell. [antibody concentration 10 μg/mL]
Enhanced Validation-RNAi Western blot analysis of SGK over-expressed 293 cell line, cotransfected with SGK Validated Chimera RNAi. Blot probed with SGK monoclonal antibody (M01) clone 4D7-G3. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of SGK expression in transfected 293T cell line by SGK monoclonal antibody, clone 4D7-G3. Lanes Lane 1: SGK transfected lysate (48.9 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (73.04 kDa).
ELISA Detection limit for recombinant GST tagged SGK is approximately 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4D7-G3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC001263 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O00141 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. (provided by RefSeq)
Immunogen: SGK (AAH01263.1, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top