Advanced Search



Monoclonal Anti-SOS1 antibody produced in mouse

SIGMA/WH0006654M1 - clone 4C1, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-GF1; Anti-GGF1; Anti-GINGF; Anti-HGF; Anti-son of sevenless homolog 1 (Drosophila)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006654M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between FGFR1 and SOS1. HeLa cells were stained with anti-FGFR1 rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between CRKL and SOS1. Huh7 cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between GAB1 and SOS1. Mahlavu cells were stained with anti-GAB1 rabbit purified polyclonal 1:1200 and anti-SOS1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
ELISA Detection limit for recombinant GST tagged SOS1 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4C1, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_005633 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  proximity ligation assay: suitable
UniProt accession no. Q07889 
General description: This gene encodes a protein that is a guanine nucleotide exchange factor for RAS proteins, membrane proteins that bind guanine nucleotides and participate in signal transduction pathways. GTP binding activates and GTP hydrolysis inactivates RAS proteins. The product of this gene may regulate RAS proteins by facilitating the exchange of GTP for GDP. Mutations in this gene are associated with gingival fibromatosis 1 and Noonan syndrome type 4. (provided by RefSeq)
Immunogen: SOS1 (NP_005624, 313 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top