Advanced Search



Monoclonal Anti-SOX9 antibody produced in mouse

SIGMA/WH0006662M2 - clone 3C10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CMD1; Anti-CMPD1; Anti-SRA1; Anti-SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006662M2-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody, clone 3C10. Lanes Lane 1: SOX9 transfected lysate (56.1 kDa). Lane 2: Non-transfected lysate.
Western Blotting SOX9 monoclonal antibody, clone 3C10 Western Blot analysis of SOX9 expression in HepG2.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
Immunoprecipitation Immunoprecipitation of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with SOX9 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged SOX9 is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3C10, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_000346 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P48436 
Application: Monoclonal Anti-SOX9 antibody produced in mouse has been used in immunofluorescence.
Biochem/physiol Actions: Sex determining region Y-box 9 (SOX9), a transcription factor, is associated with the testis-determining factor sex determining region Y (SRY). It is expressed mainly in adult tissues and also in fetal testis and skeletal tissue. SOX9 consists of two functional domains: a high-mobility group (HMG) DNA-binding domain and a C-terminal transactivation domain. It plays a major role in cartilage differentiation and early testis development. It has been reported that SOX9 might play a role in chondrogenesis. Mutation of SOX9 gene in human causes campomelic dysplasia, a severe dwarfism syndrome and autosomal XY sex reversal.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. (provided by RefSeq)
Immunogen: SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top