Advanced Search



Monoclonal Anti-STX1A antibody produced in mouse

SIGMA/WH0006804M1 - clone 1F9-1C9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HPC1; Anti-STX1; Anti-p351; Anti-syntaxin 1A (brain)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006804M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunoblotting Monoclonal Anti-STX1A, Cat. No. WH0006804M1 used at the antibody concentration: 1 ~ 5 μg/mL. Specific band of ~33 kDa using human colon lysate.
Immunoblotting Monoclonal Anti-STX1A, Cat. No. WH0006804M1 used at the antibody concentration: 1 ~ 5 μg/mL. Specific band of ~33 kDa using human colon lysate.
Immunoblotting Monoclonal Anti-STX1A, Cat. No. WH0006804M1 used at the antibody concentration: 1 μg/mL. Specific band of ~53.35 kDa using immunogen protein lysate.
Western Blotting QC Western Blot detection against Immunogen (53.35 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1F9-1C9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC003011.1 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q16623 
Biochem/physiol Actions: Syntaxin 1A (STX1A) which codes for constituent of the synaptic apparatus, plays a vital role in exocytosis of neurotransmitters from neuronal cells. Hemizygous deletions of STX1A is associated with neurological symptoms of Williams syndrome (WS). STX1A regulates expression of serotonin transporter (5-HTT) involved in maintaining serotonin level; therefore, decreased expression of the protein leads to irregularity in serotonergic neurotransmission, which is associated with autism. STX1A is expressed at low level in adenocarcinoma cells, but at high level in squamous cell lung carcinomas. It might have use in determining the prognosis of lung cancer survival and initial-stage non-small-cell lung cancer (NSCLC).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM
Immunogen: STX1A (AAH03011.1, 1 a.a. ~ 251 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top