Advanced Search



Monoclonal Anti-SULT1A1 antibody produced in mouse

SIGMA/WH0006817M1 - clone 1F8, ascites fluid

Synonym: Anti-HAST1/HAST2; Anti-MGC5163; Anti-PPST; Anti-PST; Anti-ST1A3; Anti-STP; Anti-STP1; Anti-TSPST1; Anti-sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006817M1-200UL 200 µL
$524.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of SULT1A1 expression in transfected 293T cell line by SULT1A1 monoclonal antibody, clone 1F8. Lanes Lane 1: SULT1A1 transfected lysate (33.925 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (58.19 kDa).
Immunoprecipitation Immunoprecipitation of SULT1A1 transfected lysate using anti-SULT1A1 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with SULT1A1 monoclonal antibody.

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 1F8, monoclonal
conjugate unconjugated
GenBank accession no. BC000923 
isotype IgMκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1:500-1:1000
UniProt accession no. P50225 
General description: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. (provided by RefSeq)
Immunogen: SULT1A1 (AAH00923, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top