Advanced Search



Monoclonal Anti-TAF7 antibody produced in mouse

SIGMA/WH0006879M1 - clone 2C5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-TAF2F; Anti-TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa; Anti-TAFII55

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006879M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 μg/mL]
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody, clone 2C5. Lanes Lane 1: TAF7 transfected lysate (40.3 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi. Blot probed with TAF7 monoclonal antibody, clone 2C5. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting TAF7 monoclonal antibody, clone 2C5 Western Blot analysis of TAF7 expression in MCF-7.
Western Blotting QC Western Blot detection against Immunogen (36.08 kDa).
ELISA Detection limit for recombinant GST tagged TAF7 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2C5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC032737 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q15545 
General description: The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. (provided by RefSeq)
Immunogen: TAF7 (AAH32737, 130 a.a. ~ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top