Advanced Search



Monoclonal Anti-TBX3 antibody produced in mouse

SIGMA/WH0006926M10 - clone 3A10, ascites fluid

Synonym: Anti-T-box 3 (ulnar mammary syndrome); Anti-TBX3ISO; Anti-UMS; Anti-XHL

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006926M10-200UL 200 µL
$580.00
1/EA
Add To Favorites
Western Blotting TBX3 monoclonal antibody, clone 3A10. Western Blot analysis of TBX3 expression in HeLa S3 NE. (Isoform III Mw : 65.6 kDa)
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 3A10, monoclonal
conjugate unconjugated
GenBank accession no. NM_005996 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O15119 
General description: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. (provided by RefSeq)
Immunogen: TBX3 (NP_005987, 311 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top