Advanced Search



Monoclonal Anti-TCF12 antibody produced in mouse

SIGMA/WH0006938M1 - clone 2E9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HEB; Anti-HTF4; Anti-HsT17266; Anti-transcription factor 12 (HTF4, helix-loop-helix transcription factors 4)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0006938M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TCF12 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1 μg/mL]
Western Blotting Western Blot analysis of TCF12 expression in transfected 293T cell line by TCF12 monoclonal antibody, clone 2E9. Lanes Lane 1: TCF12 transfected lysate (75.8 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of TCF12 over-expressed 293 cell line, cotransfected with TCF12 Validated Chimera RNAi. Blot probed with TCF12 monoclonal antibody, clone 2E9. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting TCF12 monoclonal antibody, clone 2E9 Western Blot analysis of TCF12 expression in Jurkat.
Western Blotting QC Western Blot detection against Immunogen (35.64 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2E9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_207036 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q99081 
General description: The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. (provided by RefSeq)
Immunogen: TCF12 (NP_996919, 364 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGH
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top