Advanced Search



Monoclonal Anti-TEAD4 antibody produced in mouse

SIGMA/WH0007004M1 - clone 5H3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-EFTR2; Anti-MGC9014; Anti-RTEF1; Anti-TCF13L1; Anti-TEA domain family member 4; Anti-TEF3; Anti-TEFR1; Anti-hRTEF1B

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007004M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting JOURNAL CITATION: Hippo/YAP signaling pathway is involved in osteosarcoma chemoresistance. By: Wang, D. Y., Wu, Y. N., et al. in Chin J Cancer, 2016. PubMed ID: 27206784 Image collected and cropped by CiteAb from the following publication, (https://cancercommun.biomedcentral.com/articles/10.1186/s40880-016-0109-z), provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
Western Blotting Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 monoclonal antibody, clone 5H3. Lanes Lane 1: TEAD4 transfected lysate (34.2 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of TEAD4 over-expressed 293 cell line, cotransfected with TEAD4 Validated Chimera RNAi. Blot probed with TEAD4 monoclonal antibody, clone 5H3. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting TEAD4 monoclonal antibody, clone 5H3 Western Blot analysis of TEAD4 expression in HeLa.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
Immunoprecipitation Immunoprecipitation of TEAD4 transfected lysate using anti-TEAD4 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TEAD4 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged TEAD4 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 5H3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_003213 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity mouse
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q62296 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. (provided by RefSeq)
Immunogen: TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top