Advanced Search



Monoclonal Anti-TNNI3 antibody produced in mouse

SIGMA/WH0007137M4 - clone 1E7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CMH7; Anti-MGC116817; Anti-TNNC1; Anti-cTnI; Anti-troponin I type 3 (cardiac)

MDL Number: MFCD01864286
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007137M4-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TNNI3 on formalin-fixed paraffin-embedded human heart. [antibody concentration 0.7 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to TNNI3 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of TNNI3 expression in transfected 293T cell line by TNNI3 monoclonal antibody, clone 1E7. Lanes Lane 1: TNNI3 transfected lysate (24 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of TNNI3 over-expressed 293 cell line, cotransfected with TNNI3 Validated Chimera RNAi. Blot probed with TNNI3 monoclonal antibody, clone 1E7. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (37.73 kDa).
ELISA Detection limit for recombinant GST tagged TNNI3 is 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1E7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_000363 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P19429 
Biochem/physiol Actions: Troponin I3, cardiac type (TNNI3) or cardiac troponin I (cTnI) modulates the diastolic function of the heart. Low expression of TNNI3 is associated with cardiac diastolic dysfunction. Elevated expression of the protein indicates cardiac injury. TNNI3 is a biomarker for myocardial infarction and mutations in the gene encoding it have been linked to hypertrophic cardiomyopathy.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Troponin I3, cardiac type (TNNI3), also known as cardiac troponin I (cTnI), is the inhibitory element of troponin. It possesses an inhibitory peptide (IP) domain and a switch peptide (SP) domain that is located N-terminal of the IP domain. The gene encoding TNNI3 is localized on human chromosome 19q13.42.
Immunogen: TNNI3 (NP_000354, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top