Advanced Search



Monoclonal Anti-TOP2A antibody produced in mouse

SIGMA/WH0007153M1 - clone 1E2, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-TOP2; Anti-TP2A; Anti-topoisomerase (DNA) II alpha 170kDa

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007153M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TOP2A on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to TOP2A on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting TOP2A monoclonal antibody, clone 1E2 Western Blot analysis of TOP2A expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (36.41 kDa).
ELISA Detection limit for recombinant GST tagged TOP2A is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1E2, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_001067 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P11388 
Biochem/physiol Actions: Topoisomerase II A (TOP2A) enzyme plays a vital role in DNA replication and cell proliferation. Experimental studies show an increased expression of this enzyme in Chinese patients with gastric carcinoma. DNA topoisomerase 2-α acts as a target enzyme for an anthracycline drug called as epirubicin and many other antineoplastic drugs. Top2α is involved in reducing the topological stress in cells. The hsa-miR-485-3p downregulates the expression of nuclear transcription factor Y subunit β (NFYB), which acts as a mediator of Top2α. Consequently, it decreases the expression of Top2α and its drug responsiveness. Top2α enzyme plays an important role in maintenance of chromosome condensation and segregation. Ataxia telangiectasia mutated (ATM)-dependent regulation of TOP2A helps in TOP2 stability and also it’s sensitivity to TOP2 inhibitor.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. (provided by RefSeq)
Immunogen: TOP2A (NP_001058, 1435 a.a. ~ 1531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top