Advanced Search



Monoclonal Anti-TP53 antibody produced in mouse

SIGMA/WH0007157M1 - clone 2C3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-LFS1; Anti-TRP53; Anti-p53; Anti-tumor protein p53 (Li-Fraumeni syndrome)

MDL Number: MFCD00164709
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007157M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TP53 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to TP53 on A-431 cell. [antibody concentration 10 μg/mL]
Western Blotting TP53 monoclonal antibody, clone 2C3 Western Blot analysis of TP53 expression in A-431.
Western Blotting Western Blot analysis of TP53 expression in transfected 293T cell line by TP53 monoclonal antibody, clone 2C3. Lanes Lane 1: TP53 transfected lysate (43.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.62 kDa).
Immunoprecipitation Immunoprecipitation of TP53 transfected lysate using anti-TP53 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TP53 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged TP53 is approximately 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2C3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC003596 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P04637 
Biochem/physiol Actions: Tumor suppressor p53 has the capability to induce cell cycle arrest and has a role in DNA repair, senescence and apoptosis. It binds to Simian vacuolating virus 40 (SV40) T-antigen and human papilloma virus E6 protein. The p53 gene is mutated in various cancers, such as of the breast, ovarian, bladder, colon and lung.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: p53 is a tumor suppressor gene expressed in a wide variety of tissues. It is a tetrameric nuclear DNA-binding phosphoprotein. The gene encoding it is localized on human chromosome 17p13.1 and mouse chromosome 11.
Immunogen: TP53 (AAH03596, 94 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top